PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G009800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 713aa    MW: 78404.8 Da    PI: 6.5657
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G009800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-202883156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +++ +++t+ q++eLe++F+++++p++++r +L++ lgL+ rq+k+WFqNrR+++k
  Aqcoe3G009800.1.p 28 KKRYHRHTARQIQELERMFKECPHPDEKQRLQLSRDLGLEPRQIKFWFQNRRTQMK 83
                       688899***********************************************998 PP

2START180.78.2e-572284492206
                        HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
              START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                        ++  a++el+++ +a+ep+W++s+    + +n + + + f++++       ++ea+r+sgvv+m+ ++lv  ++d + +W e ++    ka+
  Aqcoe3G009800.1.p 228 FSANAMDELIRLLQAGEPLWMRSPvdgrDVLNLESYERMFPRTDHlknpdVRIEASRDSGVVIMNGETLVDMFMDPN-KWVELFPtlvlKAK 318
                        56789*******************999988888888888887777888989**************************.************** PP

                        EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
              START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                        +++ + sg      g lqlm+ elq+lsplv+ R+f+f+Ry++ql++g w+i dvS +s+q++ +s+++    +lpSg+li++++ng+sk+t
  Aqcoe3G009800.1.p 319 IIDILASGvvgnrsGSLQLMYEELQVLSPLVStREFYFLRYCQQLEQGLWAISDVSFESRQNQFSSPHSR---RLPSGCLIQDMPNGYSKIT 407
                        **************************************************************98544444...6****************** PP

                        EEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 166 wvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                        wvehv++++++p h l+r lv+sg+a+ga +w+atlqr ce+
  Aqcoe3G009800.1.p 408 WVEHVEVEEKTPsHRLYRDLVNSGMAFGAERWLATLQRMCER 449
                        ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-211285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-221687IPR009057Homeodomain-like
PROSITE profilePS5007118.1552585IPR001356Homeobox domain
SMARTSM003896.2E-192689IPR001356Homeobox domain
PfamPF000464.3E-182883IPR001356Homeobox domain
CDDcd000861.67E-182886No hitNo description
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PROSITE profilePS5084848.862218452IPR002913START domain
SuperFamilySSF559613.41E-38219450No hitNo description
CDDcd088751.59E-121222448No hitNo description
SMARTSM002341.7E-47227449IPR002913START domain
PfamPF018524.0E-49228449IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-7286448IPR023393START-like domain
SuperFamilySSF559611.76E-24470704No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MDSGSGGGGG GASGDDQDVS DPHNQRKKKR YHRHTARQIQ ELERMFKECP HPDEKQRLQL  60
SRDLGLEPRQ IKFWFQNRRT QMKAQHERAD NCALRSENDK IRCENIAIRE ALKHVICPSC  120
GGPPMGSTED IYFDEQKLRM DNARLKEELD RVSSIAAKYI GRPISQLPPI QPVSVTSLEL  180
SMGSFGAQGM AGPSLDLDLL PGTSSSLPTL PLQSFGISDM EKSLMAEFSA NAMDELIRLL  240
QAGEPLWMRS PVDGRDVLNL ESYERMFPRT DHLKNPDVRI EASRDSGVVI MNGETLVDMF  300
MDPNKWVELF PTLVLKAKII DILASGVVGN RSGSLQLMYE ELQVLSPLVS TREFYFLRYC  360
QQLEQGLWAI SDVSFESRQN QFSSPHSRRL PSGCLIQDMP NGYSKITWVE HVEVEEKTPS  420
HRLYRDLVNS GMAFGAERWL ATLQRMCERF ACLMVTGTST RDLGGVIPSP DGRRSMMKLS  480
QRMINNFCAS ISASNGHRWT TLSGLNDVGV RVTVHKSTDP GQPNGVVLSA ATSIWLPVSS  540
QNVFNFFRDE RSRPQWDVLS NGNSVQEVAH IANGSHPGNS ISILRAFNAS HNMLILQESC  600
TDSSGSSLVV YASVDLPAIN IAMSGEDPSY IPLLPSGFAI LPDGRPDQGA AGASTSSSTV  660
SRSGGSLVTV AFQILVSSLP NAKLNLESVN TVNNLISTTV QQIKAALNCS GS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268321.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X1
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLW9RIV50.0W9RIV5_9R
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11